Dalke Scientific Software: More science. Less time. Products
Products

EUtils

EUtils is a client-side library for the Entrez databases at NCBI.

NCBI provides the EUtils web service so that software can query Entrez directly, rather than going through the web interface and dealing with the hassles of web scraping.

This package provides two levels of interface. The lowest one makes a programmatic interface to construct the query URL and make the request. The higher level ones support history tracking and parsing of query results. These greatly simplify working with the EUtils server.


Download: EUtils-1.0p1.tar.gz [CHANGELOG]
EUtils is distributed under the Biopython License

To purchase commercial support or to hire us to develop customized tools built using EUtils, contact info@dalkescientific.com.


Example: Get all protein sequences related to protein GI:4579714:
>>> import EUtils
>>> from EUtils import HistoryClient
>>> client = HistoryClient.HistoryClient()
>>> result = client.post(EUtils.DBIds("protein", "4579714"))
>>> related = result.neighbor_links("protein")
>>> related_dbids = related.linksetdbs["protein_protein"].dbids
>>> proteins = client.post(related_dbids)
>>> len(proteins)
223
>>> infile = proteins.efetch(retmode = "text", rettype = "fasta")
>>>
>>> fasta = infile.read()
>>> print fasta[:788]
>gi|27450749|gb|AAO14677.1|AF508258_1 rhodopsin [Pyrocystis lunula]
MAPIPDGFTYGQWSLVYNSLSFGIAGMGCATIFFWLQLPNVSKSYRTALTITGLVTAIATYHYVRIFNSW
VDAFKVVNVNGGDYTVTLLGAPFNDAYRYVDWLLTVPLLLIELILVMKLPKAETVKLSWNLGVASAVMVA
LGYPGEIQDDLLVRWFWWAMAMIPFYYVVVTLVNGLSDATAKQPDSVKSLVVTARYLTVISWLTYPGVYI
IKSMGLAGNIATTYEQVGYSVADVVAKAVFGVLIWAIAAGKSDEEEKNGLLG

>gi|6319528|ref|NP_009610.1| Homolog to HSP30 heat shock protein Yro1p; Yro2p [Saccharomyces cerevisiae]
MSDYVELLKRGGNEAIKINPPTGADFHITSRGSDWLFTVFCVNLLFGVILVPLMFRKPVKDRFVYYTAIA
PNLFMSIAYFTMASNLGWIPVRAKYNHVQTSTQKEHPGYRQIFYARYVGWFLAFPWPIIQMSLLGGTPLW
QIAFNVGMTEIFTVCWLIAACVHSTYKWGYYTIGIGAAIVVCISLMTTTFNLVKARGKDVSNVFITFMSV
IMFLWLIAYPTCFGITDGGNVLQPDSATIFYGIIDLLILSILPVLFMPLANYLGIERLGLIFDEEPAEHV
GPVAEKKMPSPASFKSSDSDSSIKEKLKLKKKHKKDKKKAKKAKKAKKAKKAQEEEEDVATDSE
>>>


Contact Us | Home
Copyright © 2001-2013 Andrew Dalke Scientific AB. All rights reserved.
Company
Contact Us
News